PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_32074_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 327aa    MW: 37519.2 Da    PI: 4.8628
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_32074_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.8e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g+ R++k+c++rw +yl
   Neem_32074_f_1 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.23e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
   Neem_32074_f_1  71 SEYEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.636961IPR017930Myb domain
SuperFamilySSF466896.74E-2711108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001672.36E-81661No hitNo description
PROSITE profilePS5129425.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2464116IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.9E-1471111IPR001005SANT/Myb domain
CDDcd001673.24E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHKPLS TIEQPQKQPP QMQNQEEEQQ LQPQGSSLMI NAMSETEQNK EPETCLRSSI  180
TEVKEEDKST RSSFDTTMEI MNNSFCTDDV PLIQPHEILV PCLPTTSTTT TTSSSSCSSN  240
SSENSSKFLE EWQFPDFEWP ACDYVNNNNN NINSIENIGL WDEDFSSWDL LINDDEDGDR  300
KLAFVDPPFS QCPRMDLDQD SWKFGLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0086641e-34KF008664.1 Scutellaria baicalensis MYB15 (myb) mRNA, partial cds.
GenBankLN6862831e-34LN686283.1 Cucumis melo genomic scaffold, unassembled_sequence33761.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482113.11e-149PREDICTED: protein ODORANT1
SwissprotQ50EX62e-87ODO1_PETHY; Protein ODORANT1
TrEMBLA0A067EIR91e-148A0A067EIR9_CITSI; Uncharacterized protein
STRINGPOPTR_0017s02850.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-97myb domain protein 20